Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2.. Product #: 1208-005 Regular price: $151.00 $151.00

Cecropin B

Product Code: 1208-005
Weight: 0.50mg

Price: $151.00

Available Options

* Package Size:

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.

Ref: Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004).
Chemistry
Purity > 95% By HPLC
Molecular Weight 3834.7
Sequence KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Sequence (3 Letter) H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Biology
Storage Store at -20°C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.