Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide

Product Code: 1267-005

Price: $186.00

Available Options

* Package Size:
- +
Overview
Description This is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family, including Bak, Bax, and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL, antagonize its anti-apoptotic function, and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.
Sequence RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Sequence (3 Letter) H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
Molecular Weight 4404.3
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Holinger, E. et al. J. Biol. Chem. 274, 13298 (1999).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.