Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Anti-Virals


Show:
Sort By:
HIV Substrate

KARVNleF(4-NO2)EANle-NH2

$44.00

HIV - 1 MN #2025

GKLICTTTVPWNASWSNKSL

$145.00

SIVmac239 envelope - 87

RWILAIPRRIRQGLELTLL

$141.00

T20

Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2

$239.00

Biotin - TAT (47 - 57)

Biotin-YGRKKRRQRRR

$78.00

Cys(Npys) - TAT (47 - 57)

C(Npys)YGRKKRRQRRR-NH2

$156.00

Cys - TAT (47 - 57)

CYGRKKRRQRRR-NH2

$65.00

FITC - LC - TAT (47 - 57)

FITC-LC-YGRKKRRQRRR-NH2

$138.00

TAT (47 - 57)

YGRKKRRQRRR

$80.00

TAT (47 - 57) GGG - Cys(Npys)

YGRKKRRQRRRGGG-C(Npys)-NH2

$159.00

C34 - LC - Biotin, gp41 HIV fragment

WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)

$97.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.