Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Fluorescent Labeled Peptides


Show:
Sort By:
Beta - Amyloid (1 - 40), Rhodamine Green - labeled

Rhodamine Green-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

$101.00

BAD (103 - 127), human, FAM - labeled

FAM-NLWAAQRYGRELRRMSDEFVDSFKK

$193.00

Bak - BH3, TAMRA - labeled

GQVGRQLAIIGDDINR-K(TAMRA)-NH2

$193.00

Bombesin, FAM - labeled

FAM-EQRLGNQWAVGHLM-NH2

$98.00

(Arg)9, FAM - labeled

FAM-RRRRRRRRR

$211.00

(Arg)9, TAMRA - labeled

TAMRA-RRRRRRRRR

$236.00

Cys(Npys) - TAT (47 - 57), FAM - labeled

C(Npys)YGRKKRRQRRR-K(FAM)-NH2

$197.00

Endothelin 1, human, FAM - labeled

FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)

$277.00

Exendin 4, FAM - labeled

FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

$376.00

C2 substrate, (DABCYL/EDANS)

DABCYL -SLGRKIQI-EDANS

$116.00

Cls Substrate, C2 (5 - FAM/ QXL 520)

5-FAM-SLGRKIQIQ-K(QXL 520)-NH2

$201.00

Cls Substrate, C2 (Abz/Dnp)

2Abz-SLGRKIQIK(Dnp)-NH2

$118.00

HCV Protease FRET Substrate (RET S1)

Ac-DE-D(Edans)-EE-Abu-ψ

$160.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.