Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects. |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG |
Sequence (3 Letter) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-OH |
Molecular Weight | 3674 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.