Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Toxins


Show:
Sort By:
ω - Conotoxin GVIA
CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2

CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2

$205.00

Apamin
CNCKAPETALCARRCQQH - NH2 (Disulfide bridge: 1 - 11, 3 - 15)

CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11, 3-15)

$101.00

Conantokin G
GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN - NH2

GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2

$205.00

Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33, 17 - 35)

Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)

$150.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.