Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Urocortin III, mouse

Product Code: N4006

Price: $166.00

Available Options

* Package Size:
- +
Overview
Synonyms Ucn III; UcnIII; Ucn 3; Ucn3UrocortinIII; Urocortin 3; Urocortin3; LOC498791 Peptide
Description Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
Cas No 357952-10-4
Sequence {PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
Sequence Shortening FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Molecular Formula C186H312N52O52S2
C Terminal NH2
Molecular Weight 4172.97
Properties
Purity > 95%
Solubility Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
Gmp Flag 0
Storage Store at -20°C

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.