Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Anti-Inflammatory Peptides


Show:
Sort By:
aKChaVAAWTLKAAa - Ahx - C

aK-Cha-VAAWTLKAAa-Ahx-C

$124.00

Cecropin A

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

$157.00

Cecropin B

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

$151.00

Histatin - 5

DSHAKRHHGYKRKFHEKHHSHRGY

$128.00

Magainin 1

GIGKFLHSAGKFGKAFVGEIMKS

$86.00

Magainin 2

GIGKFLHSAKKFGKAFVGEIMNS

$86.00

Indolicidin

ILPWKWPWWPWRR-NH2

$126.00

Elafin

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)

$210.00

LL - 37, Antimicrobial Peptide, human

[LL-37, 37 aa]

$115.00

mCRAMP, mouse

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

$181.00

rCRAMP

GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ

$196.00

CAP - 18, rabbit

GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY

$197.00

SMAP 29, Sheep Myeloid Antimicrobial Peptide 29

RGLRRLGRKIAHGVKKYGPTVLRIIRIAG

$152.00

LL - 37 pentamide

LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS

$198.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.