Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Anti-Inflammatory Peptides


Show:
Sort By:
OV - 1, sheep

KNLRRIIRKIIHIIKKYG

$76.00

LL - 37, reverse sequence

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

$127.00

Dermaseptin

ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ

$211.00

Apidaecin IB

GNNRPVYIPQPRPPHPRL

$74.00

Mundticin

KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWSK (Disulfide bridge: 9-14)

$203.00

Aurein 1.1

GLFDIIKKIAESI-NH2

$74.00

HEL (46 - 61)

NTDGSTDYGILQINSR

$123.00

Melittin, honey bee

GIGAVLKVLTTGLPALISWIKRKRQQ-NH2

$118.00

Pyrrhocoricin

VDKGSYLPRPTPPRPIYNRN

$81.00

Drosocin

GKPRPYSPRPTSHPRPIRV

$78.00

Ubiquitin (1 - 34)

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE

$199.00

Biotin - LC - LL - 37

Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

$254.00

5 - FAM - LC - LL - 37

5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

$113.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.